PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G026643_P02
Common NameHDZIV1_OCL1, Zm.224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 803aa    MW: 85946.2 Da    PI: 5.3013
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G026643_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox702.8e-22103158156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe+lF+++++p++++r eL+k+lgL+ rqVk+WFqNrR+++k
  GRMZM2G026643_P02 103 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSKRLGLDPRQVKFWFQNRRTQMK 158
                        678899***********************************************999 PP

2START186.41.5e-583125451206
                        HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S.. CS
              START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv......dsgealrasgvvdmvla.llveellddkeqWdetla.. 77 
                        ela +a++elvk+a+++ep+W  s       + +n +e+  +f++s +      + +ea+r+sg+v+ +    lve+l+d++ +W+ ++   
  GRMZM2G026643_P02 312 ELAISAMDELVKLAQVDEPLWLPSLsgspdkKLLNFEEYAHSFSPSVGavkpvgYVSEASRESGLVIIDNSlALVETLMDVR-RWSDMFScm 402
                        57889*****************999899988888999999999998779*****************9876658999999999.********* PP

                        ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSEEEEEE CS
              START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgilie 155
                          ka++le ++sg      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    +++ +R+++lpSg++++
  GRMZM2G026643_P02 403 iaKATVLEEVTSGiagsrnGALLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDHNSGtasNAGNIRCRRLPSGCVMQ 494
                        **************************************************************965566666677899*************** PP

                        EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        +++ng++kvtwve ++++++++h+l+r+l++sgla+ga++w+a lqrqce+
  GRMZM2G026643_P02 495 DTPNGYCKVTWVEYTEYDEASVHQLYRPLIRSGLAFGARRWLAMLQRQCEC 545
                        *************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2388160IPR009057Homeodomain-like
SuperFamilySSF466891.09E-2188160IPR009057Homeodomain-like
PROSITE profilePS5007118.285100160IPR001356Homeobox domain
SMARTSM003892.8E-21101164IPR001356Homeobox domain
CDDcd000864.42E-20102160No hitNo description
PfamPF000469.5E-20103158IPR001356Homeobox domain
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
PROSITE profilePS5084847.244303548IPR002913START domain
SuperFamilySSF559612.89E-31305545No hitNo description
CDDcd088751.45E-114307544No hitNo description
SMARTSM002342.2E-45312545IPR002913START domain
PfamPF018523.2E-51313545IPR002913START domain
SuperFamilySSF559611.99E-21565769No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0004006anatomymesophyll cell
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MSFGSLFDGG SGGGGGGGGM QFPFSTGFSS SPALSLGLEN PGGGMVGRML PVGGAPAAGG  60
MARDAADAEN DSRSGSDHLD AMSAGAGAED EDDAEPGNPR KRKKRYHRHT PQQIQELEAL  120
FKECPHPDEK QRGELSKRLG LDPRQVKFWF QNRRTQMKTQ LERHENALLK QENDKLRAEN  180
MAIREAMRSP MCGSCGSPAM LGEVSLEEQH LCIENARLKD ELNRVYALAT KFLGKPMPVL  240
SGPMLQPNLS LPMPSSSLEL AVGGLRGLGS IPSLDEFAGG VSSPLGTVIT PARATGSAPP  300
PMVGVDRSML LELAISAMDE LVKLAQVDEP LWLPSLSGSP DKKLLNFEEY AHSFSPSVGA  360
VKPVGYVSEA SRESGLVIID NSLALVETLM DVRRWSDMFS CMIAKATVLE EVTSGIAGSR  420
NGALLLMKAE LQVLSPLVPI REVTFLRFCK QLAEGAWAVV DVSIDGLVRD HNSGTASNAG  480
NIRCRRLPSG CVMQDTPNGY CKVTWVEYTE YDEASVHQLY RPLIRSGLAF GARRWLAMLQ  540
RQCECLAILM SPDTVSANDS SVITQEGKRS MLKLARRMTE NFCAGVSASS AREWSKLDGA  600
AGSIGEDVRV MARKSVDEPG EPPGVVLSAA TSVWVPVAPE KLFNFLRDEQ LRAEWDILSN  660
GGPMQEMANI AKGQEHGNSV SLLRASAMSA NQSSMLILQE TCTDASGSMV VYAPVDIPAM  720
QLVMNGGDST YVALLPSGFA ILPDGPSSVG AEHKTGGSLL TVAFQILVNS QPTAKLTVES  780
VETVNNLIFC TIKKIKTALQ CDA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198104PRKRKKR
299103RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.2240.0ear| embryo| meristem| ovary| pericarp| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G026643
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G026643_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0644530.0BT064453.1 Zea mays full-length cDNA clone ZM_BFc0170E20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105493.10.0outer cell layer 1
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLC0P8340.0C0P834_MAIZE; Homeodomain leucine zipper family IV protein
STRINGGRMZM2G026643_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]